PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr037662.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family GRAS
Protein Properties Length: 262aa    MW: 29743.7 Da    PI: 4.7173
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr037662.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS157.41.2e-4811258157373
         GRAS 157 eleetgerLakfAeelgvpfefnvl.......vakrledleleeLrvkp.gEalaVnlvlqlhrll.........................desvsle 221
                  ++ee+g++L +fA++ ++ +ef+v+        a+ +++l++++L   +  Eal+Vn++++lh++                          ++s s++
  Pbr037662.1  11 SYEELGSKLVNFARSRNIILEFRVIpssytdgFANLIQQLRVQNLVYAEsSEALVVNCHMMLHYISeealtlpainpnpssggstssygfdASSSSSS 108
                  5799*********************8885555555555556666655559****************************************88888888 PP

         GRAS 222 serdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerl 319
                  s r+ +Lk +++l+P++vv+v++++d++s++ + r+ +a++y +  +d+l++ lpr s++r+++E+  + ++i+nv+a eg++r+er e + +W +r+
  Pbr037662.1 109 SLRTVFLKELRGLEPTIVVLVDEDVDLTSNNPVCRLRSAFNYLWIPYDTLDTFLPRGSKQRQWYEAD-VCWKIENVIAYEGFQRVERLEPKCRWVQRM 205
                  89*****************************************************************.99**************************** PP

         GRAS 320 eeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                  ++a F++v+++e+a+ ++k++l +++  g+ ++ e++ +vl+Wk++++v+++aW
  Pbr037662.1 206 RNANFRSVSFGEDAVLEVKTMLDEHA-TGWGLKREEEDVVLTWKGHNVVFATAW 258
                  **************************.9999*********************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098520.4231240IPR005202Transcription factor GRAS
PfamPF035144.2E-4611258IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 262 aa     Download sequence    Send to blast
MEDVPPMLDL SYEELGSKLV NFARSRNIIL EFRVIPSSYT DGFANLIQQL RVQNLVYAES  60
SEALVVNCHM MLHYISEEAL TLPAINPNPS SGGSTSSYGF DASSSSSSSL RTVFLKELRG  120
LEPTIVVLVD EDVDLTSNNP VCRLRSAFNY LWIPYDTLDT FLPRGSKQRQ WYEADVCWKI  180
ENVIAYEGFQ RVERLEPKCR WVQRMRNANF RSVSFGEDAV LEVKTMLDEH ATGWGLKREE  240
EDVVLTWKGH NVVFATAWMP A*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009344465.10.0PREDICTED: putative scarecrow-like protein 16, partial
SwissprotQ9SN221e-100SCL32_ARATH; Scarecrow-like protein 32
TrEMBLD9ZJB51e-164D9ZJB5_MALDO; SCL domain class transcription factor
STRINGPOPTR_0007s10030.11e-143(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77023347
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49950.11e-100GRAS family protein